SCOPe 2.07: Domain d3vune_: 3vun E:

Lineage for d3vune_ (3vun E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (21 species)
   not a true protein

7. Species Influenza A virus [TaxId:387139] [256143] (1 PDB entry)

8. Domain d3vune_: 3vun E: [250693]
   Other proteins in same PDB: d3vunb_, d3vund_, d3vunf_
   automated match to d2hmga_
   complexed with nag

Details for d3vune_

PDB Entry: 3vun, 3 Å

PDB Description: crystal structure of a influenza a virus (a/aichi/2/1968 h3n2) hemagglutinin in c2 space group.

PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3vune_:

Sequence; same for both SEQRES and ATOM records:

>d3vune_ b.19.1.2 (E:) automated matches {Influenza A virus [TaxId: 387139]}
dnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
wtgvtqnggsnackrgpssgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
kyvkqntlklatgmrnvpe

Timeline for d3vune_:

• d3vune_ first appeared in SCOPe 2.04
  
• d3vune_ appears in SCOPe 2.06
  
• d3vune_ appears in the current release, SCOPe 2.08