SCOPe 2.05: Domain d3vrqb1: 3vrq B:148-233

Lineage for d3vrqb1 (3vrq B:148-233)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (27 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (38 PDB entries)

8. Domain d3vrqb1: 3vrq B:148-233 [250668]
   Other proteins in same PDB: d3vrqa2, d3vrqb2
   automated match to d3buxb1
   complexed with ca; mutant

Details for d3vrqb1

PDB Entry: 3vrq, 2.39 Å

PDB Description: Crystal structure of the tyrosine kinase binding domain of Cbl-c (PL mutant)

PDB Compounds: (B:) Signal transduction protein CBL-C

SCOPe Domain Sequences for d3vrqb1:

Sequence, based on SEQRES records:

>d3vrqb1 a.39.1.0 (B:148-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
myqltkapahtfwrescgarcvlpwaefesllgtchpvepgctalalrttidltcsghvs
ifefdvftrlfqpwptllknwqllav

Sequence, based on observed residues (ATOM records):

>d3vrqb1 a.39.1.0 (B:148-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
myqltkapahtfwrescgarcvlpwaefesllgtchptalalrttidltcsghvsifefd
vftrlfqpwptllknwqllav

Timeline for d3vrqb1:

• d3vrqb1 first appeared in SCOPe 2.04
  
• d3vrqb1 appears in SCOPe 2.06
  
• d3vrqb1 appears in the current release, SCOPe 2.08