SCOPe 2.05: Domain d3vono_: 3von O:

Lineage for d3vono_ (3von O:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187072] (30 PDB entries)

8. Domain d3vono_: 3von O: [250639]
   Other proteins in same PDB: d3vonb_, d3vonc_, d3vond_, d3vone_, d3vonf_, d3vong_, d3voni_, d3vonj_, d3vonk_, d3vonl_, d3vonm_, d3vonn_, d3vonp_, d3vonq_, d3vonr_, d3vons_, d3vont_, d3vonu_, d3vonw_, d3vonx_, d3vony_, d3vonz_
   automated match to d4i6la_

Details for d3vono_

PDB Entry: 3von, 3.15 Å

PDB Description: Crystalstructure of the ubiquitin protease

PDB Compounds: (O:) Ubiquitin thioesterase OTUB1

SCOPe Domain Sequences for d3vono_:

Sequence, based on SEQRES records:

>d3vono_ d.3.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nplvserlelsvlykeyaeddniyqqkikdlhkkysyirktrpdgncfyrafgfshleal
lddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfnd
qstsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiiala
qalsvsiqveymdrgeggttnphifpegsepkvyllyrpghydilyk

Sequence, based on observed residues (ATOM records):

>d3vono_ d.3.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nplvserlelsvlykeyaniyqqkikdlhkkysyirktrpdgncfyrafgfshlealldd
skelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfndqst
sdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiialaqal
svsiqveymdphifpegsepkvyllyrpghydilyk

Timeline for d3vono_:

• d3vono_ first appeared in SCOPe 2.04
  
• d3vono_ appears in SCOPe 2.06
  
• d3vono_ appears in the current release, SCOPe 2.08