Lineage for d3vona_ (3von A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927640Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2927641Protein automated matches [190230] (23 species)
    not a true protein
  7. 2927669Species Human (Homo sapiens) [TaxId:9606] [187072] (53 PDB entries)
  8. 2927747Domain d3vona_: 3von A: [250625]
    Other proteins in same PDB: d3vonb_, d3vonc_, d3vond_, d3vone_, d3vonf_, d3vong_, d3voni_, d3vonj_, d3vonk_, d3vonl_, d3vonm_, d3vonn_, d3vonp_, d3vonq_, d3vonr_, d3vons_, d3vont_, d3vonu_, d3vonw_, d3vonx_, d3vony_, d3vonz_
    automated match to d4i6la_

Details for d3vona_

PDB Entry: 3von (more details), 3.15 Å

PDB Description: Crystalstructure of the ubiquitin protease
PDB Compounds: (A:) Ubiquitin thioesterase OTUB1

SCOPe Domain Sequences for d3vona_:

Sequence, based on SEQRES records: (download)

>d3vona_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nplvserlelsvlykeyaeddniyqqkikdlhkkysyirktrpdgncfyrafgfshleal
lddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfnd
qstsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiiala
qalsvsiqveymdrgeggttnphifpegsepkvyllyrpghydily

Sequence, based on observed residues (ATOM records): (download)

>d3vona_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nplvserlelsvlykeqqkikdlhkkysyirktrpdgncfyrafgfshleallddskelq
rfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfndqstsdylv
vylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiialaqalsvsiq
veymdphifpegsepkvyllyrpghydily

SCOPe Domain Coordinates for d3vona_:

Click to download the PDB-style file with coordinates for d3vona_.
(The format of our PDB-style files is described here.)

Timeline for d3vona_: