Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
Protein automated matches [190230] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187072] (53 PDB entries) |
Domain d3vona_: 3von A: [250625] Other proteins in same PDB: d3vonb_, d3vonc_, d3vond_, d3vone_, d3vonf_, d3vong_, d3voni_, d3vonj_, d3vonk_, d3vonl_, d3vonm_, d3vonn_, d3vonp_, d3vonq_, d3vonr_, d3vons_, d3vont_, d3vonu_, d3vonw_, d3vonx_, d3vony_, d3vonz_ automated match to d4i6la_ |
PDB Entry: 3von (more details), 3.15 Å
SCOPe Domain Sequences for d3vona_:
Sequence, based on SEQRES records: (download)
>d3vona_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nplvserlelsvlykeyaeddniyqqkikdlhkkysyirktrpdgncfyrafgfshleal lddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfnd qstsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiiala qalsvsiqveymdrgeggttnphifpegsepkvyllyrpghydily
>d3vona_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nplvserlelsvlykeqqkikdlhkkysyirktrpdgncfyrafgfshleallddskelq rfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfndqstsdylv vylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiialaqalsvsiq veymdphifpegsepkvyllyrpghydily
Timeline for d3vona_: