Lineage for d3vmfa3 (3vmf A:323-430)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2063485Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2063486Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2063593Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2063594Protein automated matches [254425] (16 species)
    not a true protein
  7. 2063595Species Aeropyrum pernix [TaxId:272557] [256139] (2 PDB entries)
  8. 2063596Domain d3vmfa3: 3vmf A:323-430 [250618]
    Other proteins in same PDB: d3vmfa1, d3vmfa2
    automated match to d1jnya2
    complexed with gtp, mg, so4

Details for d3vmfa3

PDB Entry: 3vmf (more details), 2.3 Å

PDB Description: Archaeal protein
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d3vmfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vmfa3 b.44.1.0 (A:323-430) automated matches {Aeropyrum pernix [TaxId: 272557]}
aeefearifviwhpsaitvgytpvihvhtasvssriieikakldpktgqvveqnpqflka
gdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgigivtdvkpa

SCOPe Domain Coordinates for d3vmfa3:

Click to download the PDB-style file with coordinates for d3vmfa3.
(The format of our PDB-style files is described here.)

Timeline for d3vmfa3: