Class b: All beta proteins [48724] (177 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (16 species) not a true protein |
Species Aeropyrum pernix [TaxId:272557] [256139] (2 PDB entries) |
Domain d3vmfa3: 3vmf A:323-430 [250618] Other proteins in same PDB: d3vmfa1, d3vmfa2 automated match to d1jnya2 complexed with gtp, mg, so4 |
PDB Entry: 3vmf (more details), 2.3 Å
SCOPe Domain Sequences for d3vmfa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vmfa3 b.44.1.0 (A:323-430) automated matches {Aeropyrum pernix [TaxId: 272557]} aeefearifviwhpsaitvgytpvihvhtasvssriieikakldpktgqvveqnpqflka gdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgigivtdvkpa
Timeline for d3vmfa3: