SCOPe 2.05: Domain d3vkla2: 3vkl A:155-317

Lineage for d3vkla2 (3vkl A:155-317)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (48 PDB entries)

8. Domain d3vkla2: 3vkl A:155-317 [250569]
   automated match to d3ap6d_
   complexed with edo; mutant

Details for d3vkla2

PDB Entry: 3vkl, 2.55 Å

PDB Description: protease-resistant mutant form of human galectin-8 in complex with two lactose molecules

PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d3vkla2:

Sequence; same for both SEQRES and ATOM records:

>d3vkla2 b.29.1.0 (A:155-317) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmrlpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlnikafv
rnsflqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfkelssi
dtleingdihllevrsw

Timeline for d3vkla2:

• d3vkla2 first appeared in SCOPe 2.04
  
• d3vkla2 appears in SCOPe 2.06
  
• d3vkla2 appears in the current release, SCOPe 2.08