SCOPe 2.04: Domain d3vgha3: 3vgh A:491-557

Lineage for d3vgha3 (3vgh A:491-557)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Glycosyltrehalose trehalohydrolase [51034] (2 species)

7. Species Sulfolobus solfataricus, km1 [TaxId:2287] [51035] (8 PDB entries)

8. Domain d3vgha3: 3vgh A:491-557 [250558]
   Other proteins in same PDB: d3vgha1, d3vgha2
   automated match to d3vgba3
   complexed with flc, gol

Details for d3vgha3

PDB Entry: 3vgh, 2.6 Å

PDB Description: crystal structure of glycosyltrehalose trehalohydrolase (e283q) complexed with maltotriosyltrehalose

PDB Compounds: (A:) Malto-oligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d3vgha3:

Sequence; same for both SEQRES and ATOM records:

>d3vgha3 b.71.1.1 (A:491-557) Glycosyltrehalose trehalohydrolase {Sulfolobus solfataricus, km1 [TaxId: 2287]}
cdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpqhieegkyefd
kgfalyk

Timeline for d3vgha3:

• d3vgha3 is new in SCOPe 2.04-stable
  
• d3vgha3 appears in SCOPe 2.05
  
• d3vgha3 appears in the current release, SCOPe 2.08