Lineage for d3vgea2 (3vge A:91-490)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818157Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1818479Protein Glycosyltrehalose trehalohydrolase, central domain [51468] (2 species)
    contains an additional N-terminal domain
  7. 1818490Species Sulfolobus solfataricus, km1 [TaxId:2287] [51469] (8 PDB entries)
  8. 1818493Domain d3vgea2: 3vge A:91-490 [250548]
    Other proteins in same PDB: d3vgea1, d3vgea3
    automated match to d3vgba2
    complexed with flc, gol

Details for d3vgea2

PDB Entry: 3vge (more details), 2.7 Å

PDB Description: crystal structure of glycosyltrehalose trehalohydrolase (d252s)
PDB Compounds: (A:) Malto-oligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d3vgea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vgea2 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Sulfolobus solfataricus, km1 [TaxId: 2287]}
fnnetflkkedliiyeihvgtftpegtfegvirkldylkdlgitaieimpiaqfpgkrdw
gydgvylyavqnsyggpegfrklvdeahkkglgvildvvynhvgpegnymvklgpyfsqk
yktpwgltfnfddaesdevrkfilenveywikeynvdgfrlsavhaiidtspkhileeia
dvvhkynriviaesdlndprvvnpkekcgynidaqwvddfhhsihayltgerqgyytdfg
nlddivksykdvfvydgkysnfrrkthgepvgeldgcnfvvyiqnhdqvgnrgkgeriik
lvdresykiaaalyllspyipmifmgeeygeenpfyffsdfsdskliqgvregrkkengq
dtdpqdestfnasklswkideeifsfykilikmrkelsia

SCOPe Domain Coordinates for d3vgea2:

Click to download the PDB-style file with coordinates for d3vgea2.
(The format of our PDB-style files is described here.)

Timeline for d3vgea2: