Lineage for d3vfca1 (3vfc A:0-138)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649553Species Mycobacterium smegmatis [TaxId:246196] [225617] (5 PDB entries)
  8. 1649557Domain d3vfca1: 3vfc A:0-138 [250538]
    Other proteins in same PDB: d3vfca2
    automated match to d3vdga1
    complexed with cl, dtt, tla

Details for d3vfca1

PDB Entry: 3vfc (more details), 2 Å

PDB Description: crystal structure of enolase msmeg_6132 (target efi-502282) from mycobacterium smegmatis str. mc2 155 complexed with tartrate
PDB Compounds: (A:) Probable glucarate dehydratase

SCOPe Domain Sequences for d3vfca1:

Sequence, based on SEQRES records: (download)

>d3vfca1 d.54.1.0 (A:0-138) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
smahnriritgarvtpvafadppllntvgvhqpyalraviqldtdagltglgetyadtvh
lerlqaaahaivgrsvfstnviralisdalggdrtgdgsglagmitsasvvdrvfspfev
acldvqgqvtgrpvsdllg

Sequence, based on observed residues (ATOM records): (download)

>d3vfca1 d.54.1.0 (A:0-138) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
smahnriritgarvtpvafadppllntvgvhqpyalraviqldtdagltglgetyadtvh
lerlqaaahaivgrsvfstnviralisdalggdragmitsasvvdrvfspfevacldvqg
qvtgrpvsdllg

SCOPe Domain Coordinates for d3vfca1:

Click to download the PDB-style file with coordinates for d3vfca1.
(The format of our PDB-style files is described here.)

Timeline for d3vfca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vfca2