Lineage for d3vfca1 (3vfc A:1-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948345Species Mycobacterium smegmatis [TaxId:246196] [225617] (5 PDB entries)
  8. 2948353Domain d3vfca1: 3vfc A:1-138 [250538]
    Other proteins in same PDB: d3vfca2, d3vfca3
    automated match to d3vdga1
    complexed with cl, dtt, tla

Details for d3vfca1

PDB Entry: 3vfc (more details), 2 Å

PDB Description: crystal structure of enolase msmeg_6132 (target efi-502282) from mycobacterium smegmatis str. mc2 155 complexed with tartrate
PDB Compounds: (A:) Probable glucarate dehydratase

SCOPe Domain Sequences for d3vfca1:

Sequence, based on SEQRES records: (download)

>d3vfca1 d.54.1.0 (A:1-138) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mahnriritgarvtpvafadppllntvgvhqpyalraviqldtdagltglgetyadtvhl
erlqaaahaivgrsvfstnviralisdalggdrtgdgsglagmitsasvvdrvfspfeva
cldvqgqvtgrpvsdllg

Sequence, based on observed residues (ATOM records): (download)

>d3vfca1 d.54.1.0 (A:1-138) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mahnriritgarvtpvafadppllntvgvhqpyalraviqldtdagltglgetyadtvhl
erlqaaahaivgrsvfstnviralisdalggdragmitsasvvdrvfspfevacldvqgq
vtgrpvsdllg

SCOPe Domain Coordinates for d3vfca1:

Click to download the PDB-style file with coordinates for d3vfca1.
(The format of our PDB-style files is described here.)

Timeline for d3vfca1: