Lineage for d3vegb_ (3veg B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950404Species Rhodococcus jostii [TaxId:101510] [256041] (8 PDB entries)
  8. 2950416Domain d3vegb_: 3veg B: [250535]
    automated match to d2gvka1
    complexed with cl, hem

Details for d3vegb_

PDB Entry: 3veg (more details), 2.35 Å

PDB Description: rhodococcus jostii rha1 dypb r244l variant in complex with heme
PDB Compounds: (B:) DypB

SCOPe Domain Sequences for d3vegb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vegb_ d.58.4.0 (B:) automated matches {Rhodococcus jostii [TaxId: 101510]}
arlapqavltppsaaslflvlvagdsdddratvcdvisgidgplkavgfrelagslscvv
gvgaqfwdrvsasskpahlhpfvplsgpvhsapstpgdllfhikaarkdlcfelgrqivs
algsaatvvdevhgfryfdsrdllgfvdgtenptdddaadsaligdedpdfrggsyvivq
kylhdmsawntlsteeqervigrtklenveldddaqpsnshvtlntivdddgvehdilld
nmafgslgeaeygtyfigyakdpavtelmlrrmflgeppgnydrvldfstaatgtlffvp
srdvleslgd

SCOPe Domain Coordinates for d3vegb_:

Click to download the PDB-style file with coordinates for d3vegb_.
(The format of our PDB-style files is described here.)

Timeline for d3vegb_: