Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (2 species) |
Species Escherichia coli [TaxId:562] [49805] (42 PDB entries) Uniprot P00722 |
Domain d3vdbb1: 3vdb B:9-219 [250483] Other proteins in same PDB: d3vdba2, d3vdba3, d3vdba4, d3vdba5, d3vdbb2, d3vdbb3, d3vdbb4, d3vdbb5, d3vdbc2, d3vdbc3, d3vdbc4, d3vdbc5, d3vdbd2, d3vdbd3, d3vdbd4, d3vdbd5 automated match to d1f49a3 complexed with 149, dms, mg, na |
PDB Entry: 3vdb (more details), 2.05 Å
SCOPe Domain Sequences for d3vdbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vdbb1 b.18.1.5 (B:9-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3vdbb1:
View in 3D Domains from same chain: (mouse over for more information) d3vdbb2, d3vdbb3, d3vdbb4, d3vdbb5 |