Lineage for d3vdac3 (3vda C:334-625)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1818879Protein beta-Galactosidase, domain 3 [51510] (2 species)
  7. 1818887Species Escherichia coli [TaxId:562] [51511] (42 PDB entries)
    Uniprot P00722
  8. 1818990Domain d3vdac3: 3vda C:334-625 [250470]
    Other proteins in same PDB: d3vdaa1, d3vdaa2, d3vdaa4, d3vdaa5, d3vdab1, d3vdab2, d3vdab4, d3vdab5, d3vdac1, d3vdac2, d3vdac4, d3vdac5, d3vdad1, d3vdad2, d3vdad4, d3vdad5
    automated match to d1jz7a5
    complexed with dms, mg, na

Details for d3vdac3

PDB Entry: 3vda (more details), 2.5 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460t)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3vdac3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vdac3 c.1.8.3 (C:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgtesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3vdac3:

Click to download the PDB-style file with coordinates for d3vdac3.
(The format of our PDB-style files is described here.)

Timeline for d3vdac3: