Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (55 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries) |
Domain d3v8ob1: 3v8o B:573-664 [250333] Other proteins in same PDB: d3v8oa3 automated match to d2dj4a1 complexed with k |
PDB Entry: 3v8o (more details), 2.8 Å
SCOPe Domain Sequences for d3v8ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v8ob1 b.1.18.0 (B:573-664) automated matches {Human (Homo sapiens) [TaxId: 9606]} kvrawgpgletgqvgksadfvveaigtevgtlgfsiegpsqakiecddkgdgscdvrywp tepgeyavhvicddedirdspfiahilpappd
Timeline for d3v8ob1: