Lineage for d3v08a2 (3v08 A:196-387)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1748371Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1748372Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 1748706Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 1748707Protein automated matches [254493] (5 species)
    not a true protein
  7. 1748733Species Horse (Equus caballus) [TaxId:9796] [256129] (5 PDB entries)
  8. 1748744Domain d3v08a2: 3v08 A:196-387 [250294]
    automated match to d4l8ua2
    complexed with br, edo, pg4, so4, unx

Details for d3v08a2

PDB Entry: 3v08 (more details), 2.45 Å

PDB Description: crystal structure of equine serum albumin
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d3v08a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v08a2 a.126.1.0 (A:196-387) automated matches {Horse (Equus caballus) [TaxId: 9796]}
rlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhkecchgdllecadd
radlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlpalaadfaedkeic
khykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccaeadppacyrtvfdq
ftplveepkslv

SCOPe Domain Coordinates for d3v08a2:

Click to download the PDB-style file with coordinates for d3v08a2.
(The format of our PDB-style files is described here.)

Timeline for d3v08a2: