SCOPe 2.06: Domain d3uv4a1: 3uv4 A:1522-1644

Lineage for d3uv4a1 (3uv4 A:1522-1644)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)

8. Domain d3uv4a1: 3uv4 A:1522-1644 [250269]
   Other proteins in same PDB: d3uv4a2, d3uv4b2
   automated match to d3hmea_
   complexed with edo, gol, po4

Details for d3uv4a1

PDB Entry: 3uv4, 1.89 Å

PDB Description: crystal structure of the second bromodomain of human transcription initiation factor tfiid subunit 1 (taf1)

PDB Compounds: (A:) second bromodomain of human Transcription initiation factor TFIID subunit 1 (TAF1)

SCOPe Domain Sequences for d3uv4a1:

Sequence; same for both SEQRES and ATOM records:

>d3uv4a1 a.29.2.0 (A:1522-1644) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkniskh
kyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekdict
ake

Timeline for d3uv4a1:

• d3uv4a1 first appeared in SCOPe 2.04, called d3uv4a_
  
• d3uv4a1 was called d3uv4a_ in SCOPe 2.05
  
• d3uv4a1 appears in SCOPe 2.07
  
• d3uv4a1 appears in the current release, SCOPe 2.08