SCOPe 2.04: Domain d3uq2a1: 3uq2 A:253-328

Lineage for d3uq2a1 (3uq2 A:253-328)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase lambda [101251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101252] (26 PDB entries)

8. Domain d3uq2a1: 3uq2 A:253-328 [250255]
   Other proteins in same PDB: d3uq2a2, d3uq2a3
   automated match to d1rzta1
   protein/DNA complex; complexed with mg, na, ppv

Details for d3uq2a1

PDB Entry: 3uq2, 2.25 Å

PDB Description: Crystal structure of the post-catalytic product complex of polymerase lambda with an rCMP inserted opposite a templating G and dAMP inserted opposite a templating T at the primer terminus.

PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3uq2a1:

Sequence; same for both SEQRES and ATOM records:

>d3uq2a1 a.60.6.1 (A:253-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
nlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmaek
iieilesghlrkldhi

Timeline for d3uq2a1:

• d3uq2a1 is new in SCOPe 2.04-stable
  
• d3uq2a1 appears in SCOPe 2.05
  
• d3uq2a1 appears in the current release, SCOPe 2.08