Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries) |
Domain d3ubxi2: 3ubx I:108-214 [250194] Other proteins in same PDB: d3ubxa1, d3ubxa2, d3ubxb_, d3ubxd1, d3ubxd2, d3ubxe_, d3ubxi1, d3ubxl1 automated match to d1tqbc2 complexed with 09n, nag |
PDB Entry: 3ubx (more details), 3.1 Å
SCOPe Domain Sequences for d3ubxi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ubxi2 b.1.1.2 (I:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d3ubxi2: