Lineage for d3ubxi1 (3ubx I:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370620Domain d3ubxi1: 3ubx I:1-107 [250193]
    Other proteins in same PDB: d3ubxa1, d3ubxa3, d3ubxb_, d3ubxd1, d3ubxd3, d3ubxe_, d3ubxi2, d3ubxl2
    automated match to d1a5fl1
    complexed with 09n, nag

Details for d3ubxi1

PDB Entry: 3ubx (more details), 3.1 Å

PDB Description: crystal structure of the mouse cd1d-c20:2-agalcer-l363 mab fab complex
PDB Compounds: (I:) L363 light chain (IGKV13-84*01)

SCOPe Domain Sequences for d3ubxi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubxi1 b.1.1.0 (I:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqssssfsvslgdratitckasediynriawyqqkpgnvprllisgatsletgvps
rfsgsgsgkdytlsitslqtedvatyycqhywsspltfgagtklelk

SCOPe Domain Coordinates for d3ubxi1:

Click to download the PDB-style file with coordinates for d3ubxi1.
(The format of our PDB-style files is described here.)

Timeline for d3ubxi1: