Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries) |
Domain d3ubxd2: 3ubx D:186-286 [250191] Other proteins in same PDB: d3ubxa1, d3ubxb_, d3ubxd1, d3ubxe_, d3ubxi2, d3ubxl2 automated match to d3hujc2 complexed with 09n, nag |
PDB Entry: 3ubx (more details), 3.1 Å
SCOPe Domain Sequences for d3ubxd2:
Sequence, based on SEQRES records: (download)
>d3ubxd2 b.1.1.0 (D:186-286) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilywhhhhhhh
>d3ubxd2 b.1.1.0 (D:186-286) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqat ldveageeaglacrvkhsslggqdiilywhhhhhhh
Timeline for d3ubxd2: