![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
![]() | Protein automated matches [190052] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186914] (32 PDB entries) |
![]() | Domain d3u8zb2: 3u8z B:215-312 [250154] Other proteins in same PDB: d3u8za1, d3u8zb1, d3u8zc1, d3u8zc2, d3u8zd1 automated match to d2zpya2 |
PDB Entry: 3u8z (more details), 2.64 Å
SCOPe Domain Sequences for d3u8zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u8zb2 b.55.1.0 (B:215-312) automated matches {Human (Homo sapiens) [TaxId: 9606]} emygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik pldkkidvfkfnssklrvnklilqlcignhdlfmrrrk
Timeline for d3u8zb2: