SCOPe 2.08: Domain d3u8zb2: 3u8z B:215-312

Lineage for d3u8zb2 (3u8z B:215-312)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)

8. Domain d3u8zb2: 3u8z B:215-312 [250154]
   Other proteins in same PDB: d3u8za1, d3u8zb1, d3u8zc1, d3u8zc2, d3u8zd1
   automated match to d2zpya2

Details for d3u8zb2

PDB Entry: 3u8z, 2.64 Å

PDB Description: human merlin ferm domain

PDB Compounds: (B:) merlin

SCOPe Domain Sequences for d3u8zb2:

Sequence; same for both SEQRES and ATOM records:

>d3u8zb2 b.55.1.0 (B:215-312) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik
pldkkidvfkfnssklrvnklilqlcignhdlfmrrrk

Timeline for d3u8zb2:

• d3u8zb2 first appeared in SCOPe 2.04
  
• d3u8zb2 appears in SCOPe 2.07