Class b: All beta proteins [48724] (180 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
Protein automated matches [190439] (22 species) not a true protein |
Species Xanthomonas axonopodis [TaxId:92829] [256113] (2 PDB entries) |
Domain d3u35b_: 3u35 B: [250080] automated match to d3dmbb_ complexed with pge |
PDB Entry: 3u35 (more details), 2.5 Å
SCOPe Domain Sequences for d3u35b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u35b_ b.45.1.0 (B:) automated matches {Xanthomonas axonopodis [TaxId: 92829]} tkelqekfwkalksdrtvmlgldgvedgharpmtaqiegdsggpiwfftskdnaliamlg qgrrvigafsskghdlfasisgslredtdpamvdrlwnpyvaawyeggktdpnlallrld adhaqiwlnessllagikvll
Timeline for d3u35b_: