Lineage for d1xtcg_ (1xtc G:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) 
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) Protein Cholera toxin [50208] (1 species) Species Vibrio cholerae [TaxId:666] [50209] (8 PDB entries) 
Domain d1xtcg_: 1xtc G: [25008]
Other proteins in same PDB: d1xtc.1
Details for d1xtcg_
PDB Entry: 1xtc (more details), 2.4 Å
PDB Description: cholera toxin
SCOP Domain Sequences for d1xtcg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtcg_ b.40.2.1 (G:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpssqhids
qkkaiermkdtlriaylteakveklctwnnktphaiaaisman
SCOP Domain Coordinates for d1xtcg_:
Click to download the PDB-style file with coordinates for d1xtcg_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xtcg_:
- d1xtcg_ appears in SCOP 1.57
- d1xtcg_ appears in the current release, SCOPe 2.08
View in 3D
