Lineage for d3u2ka_ (3u2k A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537694Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2537695Protein automated matches [226867] (15 species)
    not a true protein
  7. 2537776Species Staphylococcus aureus [TaxId:1280] [232247] (20 PDB entries)
  8. 2537797Domain d3u2ka_: 3u2k A: [250070]
    automated match to d3ttza_
    complexed with 087, mg

Details for d3u2ka_

PDB Entry: 3u2k (more details), 1.64 Å

PDB Description: s. aureus gyrb atpase domain in complex with a small molecule inhibitor
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d3u2ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u2ka_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviek
dnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkg
vpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrde
rdeenvredsyhye

SCOPe Domain Coordinates for d3u2ka_:

Click to download the PDB-style file with coordinates for d3u2ka_.
(The format of our PDB-style files is described here.)

Timeline for d3u2ka_: