Lineage for d3u2db_ (3u2d B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213592Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2213593Protein automated matches [226867] (14 species)
    not a true protein
  7. 2213674Species Staphylococcus aureus [TaxId:1280] [232247] (19 PDB entries)
  8. 2213682Domain d3u2db_: 3u2d B: [250069]
    automated match to d3ttza_
    complexed with 08b, mg

Details for d3u2db_

PDB Entry: 3u2d (more details), 1.85 Å

PDB Description: s. aureus gyrb atpase domain in complex with small molecule inhibitor
PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d3u2db_:

Sequence, based on SEQRES records: (download)

>d3u2db_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv
tdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdl
kevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenv
redsyhye

Sequence, based on observed residues (ATOM records): (download)

>d3u2db_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv
tdngrgipvdiqegrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlke
vgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvre
dsyhye

SCOPe Domain Coordinates for d3u2db_:

Click to download the PDB-style file with coordinates for d3u2db_.
(The format of our PDB-style files is described here.)

Timeline for d3u2db_: