Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (14 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [232247] (19 PDB entries) |
Domain d3u2db_: 3u2d B: [250069] automated match to d3ttza_ complexed with 08b, mg |
PDB Entry: 3u2d (more details), 1.85 Å
SCOPe Domain Sequences for d3u2db_:
Sequence, based on SEQRES records: (download)
>d3u2db_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv tdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdl kevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenv redsyhye
>d3u2db_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv tdngrgipvdiqegrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlke vgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvre dsyhye
Timeline for d3u2db_: