SCOPe 2.06: Domain d3u2da_: 3u2d A:

Lineage for d3u2da_ (3u2d A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (14 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [232247] (19 PDB entries)

8. Domain d3u2da_: 3u2d A: [250068]
   automated match to d3ttza_
   complexed with 08b, mg

Details for d3u2da_

PDB Entry: 3u2d, 1.85 Å

PDB Description: s. aureus gyrb atpase domain in complex with small molecule inhibitor

PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d3u2da_:

Sequence; same for both SEQRES and ATOM records:

>d3u2da_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviek
dnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkg
vpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrde
rdeenvredsyhye

Timeline for d3u2da_:

• d3u2da_ first appeared in SCOPe 2.04
  
• d3u2da_ appears in SCOPe 2.05
  
• d3u2da_ appears in SCOPe 2.07
  
• d3u2da_ appears in the current release, SCOPe 2.08