SCOPe 2.07: Domain d3tzvc2: 3tzv C:184-278

Lineage for d3tzvc2 (3tzv C:184-278)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d3tzvc2: 3tzv C:184-278 [250054]
   Other proteins in same PDB: d3tzva2, d3tzvc1, d3tzvd_, d3tzvg2
   automated match to d3hujc2
   complexed with d12, fuc, gol, hex, lsc, nag

Details for d3tzvc2

PDB Entry: 3tzv, 3.06 Å

PDB Description: crystal structure of an inkt tcr in complex with cd1d- lysophosphatidylcholine

PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3tzvc2:

Sequence, based on SEQRES records:

>d3tzvc2 b.1.1.0 (C:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

Sequence, based on observed residues (ATOM records):

>d3tzvc2 b.1.1.0 (C:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpsplllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetwylra
tldvvaaglscrvkhsslegqdivlyw

Timeline for d3tzvc2:

• d3tzvc2 first appeared in SCOPe 2.04
  
• d3tzvc2 appears in SCOPe 2.06
  
• d3tzvc2 appears in the current release, SCOPe 2.08