Lineage for d1fgbh_ (1fgb H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2397832Protein Cholera toxin [50208] (2 species)
    barrel, partly opened; n*=5, S*=10
  7. 2397839Species Vibrio cholerae [TaxId:666] [50209] (29 PDB entries)
    Uniprot P01556 22-124
  8. 2397975Domain d1fgbh_: 1fgb H: [25004]

Details for d1fgbh_

PDB Entry: 1fgb (more details), 2.4 Å

PDB Description: toxin
PDB Compounds: (H:) cholera toxin b subunit pentamer

SCOPe Domain Sequences for d1fgbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgbh_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1fgbh_:

Click to download the PDB-style file with coordinates for d1fgbh_.
(The format of our PDB-style files is described here.)

Timeline for d1fgbh_: