Lineage for d1fgbh_ (1fgb H:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13633Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 13634Protein Cholera toxin [50208] (1 species)
  7. 13635Species Vibrio cholerae [TaxId:666] [50209] (8 PDB entries)
  8. 13670Domain d1fgbh_: 1fgb H: [25004]

Details for d1fgbh_

PDB Entry: 1fgb (more details), 2.4 Å

PDB Description: toxin

SCOP Domain Sequences for d1fgbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgbh_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1fgbh_:

Click to download the PDB-style file with coordinates for d1fgbh_.
(The format of our PDB-style files is described here.)

Timeline for d1fgbh_: