Lineage for d3tv8a2 (3tv8 A:324-421)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810670Protein Melibiase [75020] (4 species)
  7. 2810674Species Human (Homo sapiens) [TaxId:9606] [101919] (21 PDB entries)
    alpha-galactosidase A
  8. 2810703Domain d3tv8a2: 3tv8 A:324-421 [250037]
    Other proteins in same PDB: d3tv8a1, d3tv8b1
    automated match to d3hg3a2
    complexed with 2pe, dgj, nag, so4

Details for d3tv8a2

PDB Entry: 3tv8 (more details), 2.64 Å

PDB Description: pharmacological chaperoning in human alpha-galactosidase
PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d3tv8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tv8a2 b.71.1.1 (A:324-421) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentm

SCOPe Domain Coordinates for d3tv8a2:

Click to download the PDB-style file with coordinates for d3tv8a2.
(The format of our PDB-style files is described here.)

Timeline for d3tv8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tv8a1