Lineage for d3tu5b_ (3tu5 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665022Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1665023Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1665024Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 1665144Protein automated matches [226883] (2 species)
    not a true protein
  7. 1665145Species Human (Homo sapiens) [TaxId:9606] [225058] (4 PDB entries)
  8. 1665148Domain d3tu5b_: 3tu5 B: [250035]
    Other proteins in same PDB: d3tu5a1, d3tu5a2
    automated match to d1t44g_
    complexed with atp, ca, mpd

Details for d3tu5b_

PDB Entry: 3tu5 (more details), 3 Å

PDB Description: actin complex with gelsolin segment 1 fused to cobl segment
PDB Compounds: (B:) Gelsolin, Protein cordon-bleu, Thymosin beta-4

SCOPe Domain Sequences for d3tu5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tu5b_ d.109.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqyd
lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
vasklrkvaeqt

SCOPe Domain Coordinates for d3tu5b_:

Click to download the PDB-style file with coordinates for d3tu5b_.
(The format of our PDB-style files is described here.)

Timeline for d3tu5b_: