SCOPe 2.08: Domain d3tu5b1: 3tu5 B:2-132

Lineage for d3tu5b1 (3tu5 B:2-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)

6. Protein automated matches [226883] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225058] (4 PDB entries)

8. Domain d3tu5b1: 3tu5 B:2-132 [250035]
   Other proteins in same PDB: d3tu5a1, d3tu5a2, d3tu5b2
   automated match to d1t44g_
   complexed with atp, ca, mpd

Details for d3tu5b1

PDB Entry: 3tu5, 3 Å

PDB Description: actin complex with gelsolin segment 1 fused to cobl segment

PDB Compounds: (B:) Gelsolin,Protein cordon-bleu,Thymosin beta-4

SCOPe Domain Sequences for d3tu5b1:

Sequence; same for both SEQRES and ATOM records:

>d3tu5b1 d.109.1.1 (B:2-132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydl
hywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggv
asklrkvaeqt

Timeline for d3tu5b1:

• d3tu5b1 first appeared in SCOPe 2.04, called d3tu5b_
  
• d3tu5b1 appears in SCOPe 2.07