SCOPe 2.08: Domain d3tu5a2: 3tu5 A:147-373

Lineage for d3tu5a2 (3tu5 A:147-373)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (15 PDB entries)

8. Domain d3tu5a2: 3tu5 A:147-373 [250034]
   Other proteins in same PDB: d3tu5a1, d3tu5b1, d3tu5b2
   automated match to d1c0fa2
   complexed with atp, ca, mpd

Details for d3tu5a2

PDB Entry: 3tu5, 3 Å

PDB Description: actin complex with gelsolin segment 1 fused to cobl segment

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d3tu5a2:

Sequence; same for both SEQRES and ATOM records:

>d3tu5a2 c.55.1.1 (A:147-373) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrk

Timeline for d3tu5a2:

• d3tu5a2 first appeared in SCOPe 2.04
  
• d3tu5a2 appears in SCOPe 2.07