SCOPe 2.08: Domain d3tteb2: 3tte B:133-360

Lineage for d3tteb2 (3tte B:133-360)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Bradyrhizobium sp. [TaxId:114615] [233701] (2 PDB entries)

8. Domain d3tteb2: 3tte B:133-360 [250030]
   Other proteins in same PDB: d3ttea1, d3ttea3, d3tteb1
   automated match to d3toyc2
   complexed with fmt, gol, mg, smn

Details for d3tteb2

PDB Entry: 3tte, 2 Å

PDB Description: Crystal structure of enolase brado_4202 (target EFI-501651) from Bradyrhizobium complexed with magnesium and mandelic acid

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3tteb2:

Sequence; same for both SEQRES and ATOM records:

>d3tteb2 c.1.11.0 (B:133-360) automated matches {Bradyrhizobium sp. [TaxId: 114615]}
pipaydsygvldarddertlrtacdehgfraikskgghgdlatdeamikglrallgpdia
lmldfnqsldpaeatrriarladydltwieepvpqenlsghaavrerseipiqagenwwf
prgfaeaiaagasdfimpdlmkvggitgwlnvagqadaasipmsshilpeasahvlpvtp
tahflevldfagailteplrvidgkvtakgpglglawnesavakyqvt

Timeline for d3tteb2:

• d3tteb2 first appeared in SCOPe 2.04
  
• d3tteb2 appears in SCOPe 2.07