Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (67 species) not a true protein |
Species Bradyrhizobium sp. [TaxId:114615] [233695] (2 PDB entries) |
Domain d3tteb1: 3tte B:2-132 [250029] Other proteins in same PDB: d3ttea2, d3tteb2 automated match to d3toyc1 complexed with fmt, gol, mg, smn |
PDB Entry: 3tte (more details), 2 Å
SCOPe Domain Sequences for d3tteb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tteb1 d.54.1.0 (B:2-132) automated matches {Bradyrhizobium sp. [TaxId: 114615]} ttaaitgvtaravitpmkrplrnafgvidsgplvlidvttdqgvtghsylfaytrlalkp lvhlvedigrelagkalvpvdlmkamdakfrllgwqglvgmavsgldmafwdalgqlagk pvvellggsar
Timeline for d3tteb1: