Lineage for d3ttea1 (3tte A:1-132)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2171206Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2171207Protein automated matches [226922] (87 species)
    not a true protein
  7. 2171335Species Bradyrhizobium sp. [TaxId:114615] [233695] (2 PDB entries)
  8. 2171340Domain d3ttea1: 3tte A:1-132 [250027]
    Other proteins in same PDB: d3ttea2, d3ttea3, d3tteb2
    automated match to d3toyc1
    complexed with fmt, gol, mg, smn

Details for d3ttea1

PDB Entry: 3tte (more details), 2 Å

PDB Description: Crystal structure of enolase brado_4202 (target EFI-501651) from Bradyrhizobium complexed with magnesium and mandelic acid
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3ttea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ttea1 d.54.1.0 (A:1-132) automated matches {Bradyrhizobium sp. [TaxId: 114615]}
mttaaitgvtaravitpmkrplrnafgvidsgplvlidvttdqgvtghsylfaytrlalk
plvhlvedigrelagkalvpvdlmkamdakfrllgwqglvgmavsgldmafwdalgqlag
kpvvellggsar

SCOPe Domain Coordinates for d3ttea1:

Click to download the PDB-style file with coordinates for d3ttea1.
(The format of our PDB-style files is described here.)

Timeline for d3ttea1: