SCOPe 2.05: Domain d3tt1m1: 3tt1 M:1-111

Lineage for d3tt1m1 (3tt1 M:1-111)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d3tt1m1: 3tt1 M:1-111 [250025]
   Other proteins in same PDB: d3tt1a_, d3tt1b_, d3tt1l2, d3tt1m2
   automated match to d1a5fl1
   complexed with na, sog

Details for d3tt1m1

PDB Entry: 3tt1, 3.1 Å

PDB Description: crystal structure of leut in the outward-open conformation in complex with fab

PDB Compounds: (M:) mouse monoclonal 1gG2a Fab fragment, heavy chain

SCOPe Domain Sequences for d3tt1m1:

Sequence; same for both SEQRES and ATOM records:

>d3tt1m1 b.1.1.0 (M:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliygasnles
giparfsgsgsgtdftlnihpveeedaatyycqqsnedpytfgggtkleik

Timeline for d3tt1m1:

• d3tt1m1 first appeared in SCOPe 2.04
  
• d3tt1m1 appears in SCOPe 2.06
  
• d3tt1m1 appears in the current release, SCOPe 2.08