Lineage for d3tt1a_ (3tt1 A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580866Fold f.54: SNF-like [161069] (1 superfamily)
    12 transmembrane helices; duplication: consists of two structurally similar halves
  4. 2580867Superfamily f.54.1: SNF-like [161070] (1 family) (S)
  5. 2580868Family f.54.1.1: SNF-like [161071] (2 proteins)
    Pfam PF00209; Sodium:neurotransmitter symporter
  6. 2580869Protein Na(+):neurotransmitter symporter homologue LeuT [161072] (1 species)
  7. 2580870Species Aquifex aeolicus [TaxId:63363] [161073] (38 PDB entries)
    Uniprot O67854 5-513
  8. 2580901Domain d3tt1a_: 3tt1 A: [250021]
    Other proteins in same PDB: d3tt1l1, d3tt1l2, d3tt1m1, d3tt1m2
    automated match to d2q6ha_
    complexed with na, sog

Details for d3tt1a_

PDB Entry: 3tt1 (more details), 3.1 Å

PDB Description: Crystal Structure of LeuT in the outward-open conformation in complex with Fab
PDB Compounds: (A:) Leucine transporter LeuT

SCOPe Domain Sequences for d3tt1a_:

Sequence, based on SEQRES records: (download)

>d3tt1a_ f.54.1.1 (A:) Na(+):neurotransmitter symporter homologue LeuT {Aquifex aeolicus [TaxId: 63363]}
rehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiewa
mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyfvyieswtlgfaikflv
glvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsili
rgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvw
iaavgqifftlslgfgaiityasyvrkdqdivlsgltaatlneaaevilggsisipaava
ffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaimqpmi
afledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiff
wifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtvw
itrfyiiglflfltflvflaerr

Sequence, based on observed residues (ATOM records): (download)

>d3tt1a_ f.54.1.1 (A:) Na(+):neurotransmitter symporter homologue LeuT {Aquifex aeolicus [TaxId: 63363]}
rehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiewa
mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyfvyieswtlgfaikflv
glvpetdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsilirgisk
gierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvwiaavg
qifftlslgfgaiityasyvrkdqdivlsgltaatlneaaevilggsisipaavaffgva
navaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaimqpmiafled
elklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiffwifga
dkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtvwitrfy
iiglflfltflvflaerr

SCOPe Domain Coordinates for d3tt1a_:

Click to download the PDB-style file with coordinates for d3tt1a_.
(The format of our PDB-style files is described here.)

Timeline for d3tt1a_: