SCOP 1.59: Domain d1fgbf_: 1fgb F:

Lineage for d1fgbf_ (1fgb F:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Cholera toxin [50208] (1 species)

7. Species Vibrio cholerae [TaxId:666] [50209] (9 PDB entries)

8. Domain d1fgbf_: 1fgb F: [25002]

Details for d1fgbf_

PDB Entry: 1fgb, 2.4 Å

PDB Description: toxin

SCOP Domain Sequences for d1fgbf_:

Sequence; same for both SEQRES and ATOM records:

>d1fgbf_ b.40.2.1 (F:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

Timeline for d1fgbf_:

• d1fgbf_ first appeared (with stable ids) in SCOP 1.55
  
• d1fgbf_ appears in SCOP 1.57
  
• d1fgbf_ appears in SCOP 1.61
  
• d1fgbf_ appears in the current release, SCOPe 2.08