Lineage for d1fgbf_ (1fgb F:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59002Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 59003Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 59004Protein Cholera toxin [50208] (1 species)
  7. 59005Species Vibrio cholerae [TaxId:666] [50209] (9 PDB entries)
  8. 59043Domain d1fgbf_: 1fgb F: [25002]

Details for d1fgbf_

PDB Entry: 1fgb (more details), 2.4 Å

PDB Description: toxin

SCOP Domain Sequences for d1fgbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgbf_ b.40.2.1 (F:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1fgbf_:

Click to download the PDB-style file with coordinates for d1fgbf_.
(The format of our PDB-style files is described here.)

Timeline for d1fgbf_: