Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (52 species) not a true protein |
Species Coxiella burnetii [TaxId:777] [233711] (2 PDB entries) |
Domain d3tqyb_: 3tqy B: [249991] automated match to d3ullb_ |
PDB Entry: 3tqy (more details), 2.6 Å
SCOPe Domain Sequences for d3tqyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqyb_ b.40.4.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]} argvnkvilignlgqdpevrytpngnavanvtlatsttwrdkqtgelqertewhriaffn rlaeivgeylrkgskiyiegslrtrkwqdkngvdrytteiianemhmld
Timeline for d3tqyb_: