Lineage for d3tl5a2 (3tl5 A:357-524)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1529155Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1529156Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1529157Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 1529180Protein Phoshoinositide 3-kinase (PI3K) [49570] (2 species)
  7. 1529181Species Human (Homo sapiens) [TaxId:9606] [49572] (56 PDB entries)
  8. 1529196Domain d3tl5a2: 3tl5 A:357-524 [249950]
    Other proteins in same PDB: d3tl5a1, d3tl5a3, d3tl5a4
    automated match to d1e8wa2
    complexed with 980

Details for d3tl5a2

PDB Entry: 3tl5 (more details), 2.79 Å

PDB Description: Discovery of GDC-0980: a Potent, Selective, and Orally Available Class I Phosphatidylinositol 3-Kinase (PI3K)/Mammalian Target of Rapamycin (mTOR) Kinase Inhibitor for the Treatment of Cancer
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3tl5a2:

Sequence, based on SEQRES records: (download)

>d3tl5a2 b.7.1.1 (A:357-524) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsskasaespsseskgkvqllyyvnlllidhrfllr
rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldnyc

Sequence, based on observed residues (ATOM records): (download)

>d3tl5a2 b.7.1.1 (A:357-524) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatn
pdkensmsisilldnyc

SCOPe Domain Coordinates for d3tl5a2:

Click to download the PDB-style file with coordinates for d3tl5a2.
(The format of our PDB-style files is described here.)

Timeline for d3tl5a2: