Lineage for d1ct1h_ (1ct1 H:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228614Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 228615Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 228616Species Vibrio cholerae [TaxId:666] [50209] (12 PDB entries)
  8. 228661Domain d1ct1h_: 1ct1 H: [24994]
    complexed with cl, gal, glc, nga, sia; mutant

Details for d1ct1h_

PDB Entry: 1ct1 (more details), 2.3 Å

PDB Description: cholera toxin b-pentamer mutant g33r bound to receptor pentasaccharide

SCOP Domain Sequences for d1ct1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ct1h_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1ct1h_:

Click to download the PDB-style file with coordinates for d1ct1h_.
(The format of our PDB-style files is described here.)

Timeline for d1ct1h_: