Lineage for d1ct1h_ (1ct1 H:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110115Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 110116Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 110117Protein Cholera toxin [50208] (1 species)
  7. 110118Species Vibrio cholerae [TaxId:666] [50209] (9 PDB entries)
  8. 110148Domain d1ct1h_: 1ct1 H: [24994]

Details for d1ct1h_

PDB Entry: 1ct1 (more details), 2.3 Å

PDB Description: cholera toxin b-pentamer mutant g33r bound to receptor pentasaccharide

SCOP Domain Sequences for d1ct1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ct1h_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1ct1h_:

Click to download the PDB-style file with coordinates for d1ct1h_.
(The format of our PDB-style files is described here.)

Timeline for d1ct1h_: