Lineage for d3tibb_ (3tib B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074740Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2074741Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2074742Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2075035Protein automated matches [193245] (14 species)
    not a true protein
  7. 2075086Species Influenza a virus [TaxId:382827] [193246] (9 PDB entries)
  8. 2075108Domain d3tibb_: 3tib B: [249884]
    automated match to d1ivga_
    complexed with ca, lvo

Details for d3tibb_

PDB Entry: 3tib (more details), 2.2 Å

PDB Description: crystal structure of 1957 pandemic h2n2 neuraminidase complexed with laninamivir octanoate
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d3tibb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tibb_ b.68.1.1 (B:) automated matches {Influenza a virus [TaxId: 382827]}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpgkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplsgsaqhieecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddsssnsncrnpnnergtqgvkgwafdngndlwmgrtiskesrsgyetfkvig
gwstpnsksqvnrqvivdnnnwsgysgifsvegkscinrcfyvelirgrpqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

SCOPe Domain Coordinates for d3tibb_:

Click to download the PDB-style file with coordinates for d3tibb_.
(The format of our PDB-style files is described here.)

Timeline for d3tibb_: