Lineage for d3tiab_ (3tia B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553917Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1553918Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1553919Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1554180Protein automated matches [193245] (14 species)
    not a true protein
  7. 1554233Species Influenza a virus [TaxId:382827] [193246] (9 PDB entries)
  8. 1554245Domain d3tiab_: 3tia B: [249880]
    automated match to d1ivga_
    complexed with ca, lnv, nag

Details for d3tiab_

PDB Entry: 3tia (more details), 1.8 Å

PDB Description: crystal structure of 1957 pandemic h2n2 neuraminidase complexed with laninamivir
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d3tiab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tiab_ b.68.1.1 (B:) automated matches {Influenza a virus [TaxId: 382827]}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpgkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplsgsaqhieecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddsssnsncrnpnnergtqgvkgwafdngndlwmgrtiskesrsgyetfkvig
gwstpnsksqvnrqvivdnnnwsgysgifsvegkscinrcfyvelirgrpqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

SCOPe Domain Coordinates for d3tiab_:

Click to download the PDB-style file with coordinates for d3tiab_.
(The format of our PDB-style files is described here.)

Timeline for d3tiab_: