SCOP 1.61: Domain d1eeif_: 1eei F:

Lineage for d1eeif_ (1eei F:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Cholera toxin [50208] (1 species)

7. Species Vibrio cholerae [TaxId:666] [50209] (11 PDB entries)

8. Domain d1eeif_: 1eei F: [24987]

Details for d1eeif_

PDB Entry: 1eei, 2 Å

PDB Description: cholera toxin b-pentamer complexed with metanitrophenyl-alpha-d- galactose

SCOP Domain Sequences for d1eeif_:

Sequence; same for both SEQRES and ATOM records:

>d1eeif_ b.40.2.1 (F:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

Timeline for d1eeif_:

• d1eeif_ first appeared (with stable ids) in SCOP 1.55
  
• d1eeif_ appears in SCOP 1.59
  
• d1eeif_ appears in SCOP 1.63
  
• d1eeif_ appears in the current release, SCOPe 2.08