Lineage for d3t71a1 (3t71 A:1-131)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1775547Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 1775548Protein automated matches [190824] (21 species)
    not a true protein
  7. 1775796Species Steccherinum ochraceum [TaxId:92696] [256093] (5 PDB entries)
  8. 1775824Domain d3t71a1: 3t71 A:1-131 [249823]
    automated match to d1gyca1
    complexed with cbs, cu, gol, so4

Details for d3t71a1

PDB Entry: 3t71 (more details), 2.15 Å

PDB Description: crystal structure of steccherinum ochraceum laccase obtained by multi- crystals composite data collection technique (90% dose)
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d3t71a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t71a1 b.6.1.0 (A:1-131) automated matches {Steccherinum ochraceum [TaxId: 92696]}
vqigpvtdlhivnadivpdgfvrpavnaggtfpgpviagnvgdnfqivtfnqliecsmlv
dtsihwhgefqkgtnwadgpafitqcpiivgnsfsynfnvpgmagtywyhshlttqycdg
lrgpfvvydpn

SCOPe Domain Coordinates for d3t71a1:

Click to download the PDB-style file with coordinates for d3t71a1.
(The format of our PDB-style files is described here.)

Timeline for d3t71a1: