SCOPe 2.08: Domain d3t4mg1: 3t4m G:1-207

Lineage for d3t4mg1 (3t4m G:1-207)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d3t4mg1: 3t4m G:1-207 [249783]
   Other proteins in same PDB: d3t4ma2, d3t4mb2, d3t4mc2, d3t4md2, d3t4me2, d3t4mf2, d3t4mg2, d3t4mh2, d3t4mi2, d3t4mj2
   automated match to d2ymea_
   complexed with ca, mpd, mrd, nag

Details for d3t4mg1

PDB Entry: 3t4m, 3 Å

PDB Description: ac-achbp ligand binding domain mutated to human alpha-7 nachr (intermediate)

PDB Compounds: (G:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3t4mg1:

Sequence; same for both SEQRES and ATOM records:

>d3t4mg1 b.96.1.0 (G:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqnalvthdgsvqylpa
qrlsfmcdptgvdseegatcavkfgswsysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvrfyecckepypdvnlvvkfrer

Timeline for d3t4mg1:

• d3t4mg1 first appeared in SCOPe 2.04, called d3t4mg_
  
• d3t4mg1 appears in SCOPe 2.07